| Home | Entlebuch Home | Entlebuch News | Entlebuch Firmen | Entlebuch Personen | Entlebuch Domain | Entlebuch Gemeinden | | Entlebuch Impressum |


baugespann.com

B A U G E S P N R C H I T K Nbieribonjour sorneguggisberghasenlehnheitenriedlaondalindenfeldstrassemettlenwegpaysage fluvialplatzspielraronvitus O M Z /
Erhalten Sie bis zu CHF 550 für Ihr Altgerät beim Kauf eines Surface Book

test: baugespann.com

Registrierte Domain Namen

weitere von registriere Domain Namen

Firmeneintrag

Person / Name


Presse / Nachrichten

Mittwoch, 2. Juli 2014 14:41:52 Finma genehmigt höhere Hürden für Hypotheken Die Regeln für die Vergabe von Hypotheken werden definitiv strenger: Die Finanzmarktaufsicht heisst die geplanten Massnahmen der Bankiervereinigung gut. Auch der Bundesrat hat sich geäussert.
Donnerstag, 23. Januar 2014 08:08:47 Wie die SVP die Einwanderung fördert Die SVP verhalte sich widersprüchlich, wenn sie tiefe Steuern fordere, um reiche Ausländer und Firmen anzuziehen: Die linke Kritik wird auch von Bürgerlichen geteilt.
Dienstag, 16. Juli 2013 08:46:58 Goldene Zeiten gehen zu Ende: Hypo-Zinsen steigen erneut! Die Zeiten von rekordtiefen Hypo-Zinsen sind vorbei. Seit rund einem halben Jahr steigen die Zinsen für Festhypotheken wieder. Besonders stark im letzten Quartal.